| Basic Information | |
|---|---|
| Taxon OID | 3300008469 Open in IMG/M |
| Scaffold ID | Ga0115369_10021073 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Aeronautics and Space Administration (NASA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2689 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Milos, Greece | |||||||
| Coordinates | Lat. (o) | 36.674869 | Long. (o) | 24.520916 | Alt. (m) | Depth (m) | .01 to .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004928 | Metagenome / Metatranscriptome | 418 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115369_100210732 | F004928 | GGA | LEVITMGQALHSIESEPDHTVEIVVHITETLGEQQRGNLIAAIEGNSGITTAEFCPLRYHLMLVRYDKDVSTSQDVLNCVESQNVDARLIGPV* |
| ⦗Top⦘ |