| Basic Information | |
|---|---|
| Taxon OID | 3300008464 Open in IMG/M |
| Scaffold ID | Ga0115336_167645 Open in IMG/M |
| Source Dataset Name | Deep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1042 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 27.0 | Long. (o) | -88.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105207 | Metagenome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115336_1676452 | F105207 | GAG | MLLGKGHKFLENGRYQEALEKALKAKSLKLEEQFEWLCHSIEGRSRYHLGDKENALSSLRRAQEILASKLEKEKESTPLRNIMNDITRYIEKIQRGDP* |
| ⦗Top⦘ |