Scaffold Ga0114876_1241633

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114876_1241633

Scaffold Ga0114876_1241633

Overview

Basic Information
Taxon OID	3300008448 Open in IMG/M
Scaffold ID	Ga0114876_1241633 Open in IMG/M
Source Dataset Name	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	569
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa

Source Dataset Sampling Location
Location Name	Western Lake Erie
Coordinates	Lat. (^o)	41.7032	Long. (^o)	-83.2575	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082618	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114876_12416331	F082618	AGGAGG	MVKRCELTGSLIDDLSPPGAWKEEMERIPWGYGQKQGDRLANAFVAMRRMGLHDEASLLELEIKTLRNEIEYLLNR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.