Scaffold Ga0114876_1009090

Overview

Basic Information

• Taxon OID: 3300008448
• Scaffold ID: Ga0114876_1009090
• Source Dataset Name: Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5827
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Western Lake Erie
• Coordinates
  • Lat. (^o): 41.7032
  • Long. (^o): -83.2575

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039581	Metagenome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114876_10090901	F039581	N/A	PFKVKQRLEELRLIFMYLQAAKSKVEFCLEPQKGMSLYNYAVKLLNKMECKNC*