Basic Information | |
---|---|
Taxon OID | 3300008416 Open in IMG/M |
Scaffold ID | Ga0115362_100035890 Open in IMG/M |
Source Dataset Name | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 835 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 27.4 | Long. (o) | -93.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061021 | Metagenome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115362_1000358903 | F061021 | N/A | DGSNWGGAATDKIACYGATPVIQRAYSSAVHATSALATSASFGATQLAALQEIQTTLIGLGIWATA* |
⦗Top⦘ |