NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115362_100023738

Scaffold Ga0115362_100023738


Overview

Basic Information
Taxon OID3300008416 Open in IMG/M
Scaffold IDGa0115362_100023738 Open in IMG/M
Source Dataset NameSea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)985
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.4Long. (o)-93.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021240Metagenome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0115362_1000237382F021240GGAGGMLDFNSRQNRIELIDREDRALQRCNLSAWSMPEDGQEHVLDHMLLLPRSSFGRKAINLLNWCEAPTRVKQVKDRPLVGHMSVFNARCEKERADTVNGRPFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.