Scaffold Ga0115411_1000279

Overview

Basic Information

• Taxon OID: 3300008347
• Scaffold ID: Ga0115411_1000279
• Source Dataset Name: Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764892411 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35428
• Total Scaffold Genes: 35
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (8.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064818	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0115411_100027932	F064818	N/A	MDKDEFLKKLIAFIADNSSELHPKVFKNKIRFGINKSSYTEMRFDYSQNYKGFYLQLASYNKEVGDFFEQEMGNAFLKMLEDESKEFRNLFFVQNSFQISHYYYGFPIMTNDDTGHLYPEMGTTIFNDILRNLQANHFKFIQAAEVLSPDLLHYIKKFPSCFFNTALVALLIIEKNLLSLNDERVQGLFEYDNMVTKNECKLFSPFDLIFGKKDYQQTAKRRILQRK*