| Basic Information | |
|---|---|
| Taxon OID | 3300008310 Open in IMG/M |
| Scaffold ID | Ga0103551_100064 Open in IMG/M |
| Source Dataset Name | Microbial communities from the gut of humanized mice in USA - PM96.FECAL.14dpc |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CCME-COLORADO |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2123 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From The Gut Of Humanized Mice In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | 38.65 | Long. (o) | -90.26 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103551_1000642 | F047125 | AGGA | MDVVLLLMVLGVMSSGFWAADALDHMRKEILQQEGKRRGWWS* |
| ⦗Top⦘ |