Scaffold Ga0114363_1002739

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114363_1002739

Scaffold Ga0114363_1002739

Overview

Basic Information
Taxon OID	3300008266 Open in IMG/M
Scaffold ID	Ga0114363_1002739 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9704
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (70.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location Name	Lake Erie, USA
Coordinates	Lat. (^o)	41.7026	Long. (^o)	-83.2538	Alt. (m)		Depth (m)	5.9
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042220	Metagenome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114363_100273919	F042220	AGG	MADFIQKQIESSERLYKMMLEDHKERIEKMATVYELSEHLQKKINERDAEIEKLRRRLRAYELMETM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.