Scaffold Ga0114841_1248377

Overview

Basic Information

• Taxon OID: 3300008259
• Scaffold ID: Ga0114841_1248377
• Source Dataset Name: Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 583
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.7026
  • Long. (^o): -83.2538
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050174	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114841_12483771	F050174	N/A	DLSNDIISLDHSTSNTFELTNDYIDAKHQEGKDYTDTEVENLRNEGLIQEAITQVLAWITSDEGKRFRKKVWEKIRNKWATFTGSRPYTELLDDVQQASADILDDLMKVYRYDLNNAGIRTDPFLGKDIVMKGDTYIYDGNLHLTGDIYKGTFNSVSGSWTQNKKLNDYLVLKGVKTNHCLDLNTTTELLELLY