Basic Information | |
---|---|
Taxon OID | 3300008253 Open in IMG/M |
Scaffold ID | Ga0105349_10433463 Open in IMG/M |
Source Dataset Name | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 548 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → environmental samples → uncultured virus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hudson Canyon | |||||||
Coordinates | Lat. (o) | 39.55 | Long. (o) | -72.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016285 | Metagenome | 248 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105349_104334631 | F016285 | GGA | MIKKLKMAIFLWIQGWSGQLNSWAWTKWDLLHRQDWVKGHKEWKKNNENIR* |
⦗Top⦘ |