| Basic Information | |
|---|---|
| Taxon OID | 3300008253 Open in IMG/M |
| Scaffold ID | Ga0105349_10378844 Open in IMG/M |
| Source Dataset Name | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 589 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hudson Canyon | |||||||
| Coordinates | Lat. (o) | 39.55 | Long. (o) | -72.4 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029246 | Metagenome / Metatranscriptome | 189 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105349_103788442 | F029246 | AGGAG | MGSNLGLVVLGLIALFATPFIKIAAVAAIVWGGFKAYNDWGAQ* |
| ⦗Top⦘ |