NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105354_1373748

Scaffold Ga0105354_1373748


Overview

Basic Information
Taxon OID3300008250 Open in IMG/M
Scaffold IDGa0105354_1373748 Open in IMG/M
Source Dataset NameMethane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9B Gulf of Mexico
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.37Long. (o)-90.57Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002753Metagenome / Metatranscriptome532Y

Sequences

Protein IDFamilyRBSSequence
Ga0105354_13737481F002753N/AEIESAKLTVSVRFTPAVFEIESVNNTVSVRFTPAVFEIESAKLTVSVRFTPAVFEIESVNNTVSDRFTPAVFQIESVNNTVSDRFTPATFDIESVKISDSDRFTPADFAIESVKLTDSERFTPATFDIESVNDTDSDRFTPADFDVSSVNDTDSDRFTPAALDVSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.