Scaffold Ga0105354_1188803

Overview

Basic Information

• Taxon OID: 3300008250
• Scaffold ID: Ga0105354_1188803
• Source Dataset Name: Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9B Gulf of Mexico
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 774
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.37
  • Long. (^o): -90.57

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076187	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105354_11888031	F076187	N/A	SIPDSISPALTVSTMICPDGLVSTATTHFFELINVEKFFENFNTSRNVKSFPKIPLIPEIDIFNASNLDTLFINSEWN*