Scaffold Ga0105352_1045549

Overview

Basic Information

• Taxon OID: 3300008225
• Scaffold ID: Ga0105352_1045549
• Source Dataset Name: Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8B Hudson Canyon
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1100
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location

• Location Name: Hudson Canyon
• Coordinates
  • Lat. (^o): 39.29
  • Long. (^o): -72.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096688	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105352_10455492	F096688	GAGG	MGIIKSLAVVGYATVMLLVLTGGRSANEAEFNAGHQACDAQYNMDAMQAFEMDPSEPFVQCHVAVNEAYPAAWVNWRRQNARTRGIEVAGNSGGNRRGLCG*