Scaffold Ga0105348_1001621

Overview

Basic Information

• Taxon OID: 3300008223
• Scaffold ID: Ga0105348_1001621
• Source Dataset Name: Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson Canyon
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14755
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (61.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location

• Location Name: Hudson Canyon
• Coordinates
  • Lat. (^o): 39.29
  • Long. (^o): -72.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066848	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105348_100162112	F066848	AGGA	MRFSTRSIHSLRHPQDDVYRAVSWAVGPGFAMGSSDPVLRIVLKGARQIAADRRLPVDPVAQNAGPESELDLVT*