Scaffold Ga0105356_10225139

Overview

Basic Information

• Taxon OID: 3300008222
• Scaffold ID: Ga0105356_10225139
• Source Dataset Name: Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9D Gulf of Mexico
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1085
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → unclassified Rhodothermota → Rhodothermaeota bacterium MED-G19 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.37
  • Long. (^o): -90.57

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099438	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105356_102251392	F099438	N/A	MTPVSSVFAQKAVDNREITVMAERDAKDDAEESGTFLWWCGGFLLTFVIPYVGGLPLALYGYYKGGEPDGVPAVRLMDLEKAYGKGNSEAISIYTAAYEKKYTEVARKSHGKAGLIGYGLGLLLAILAFAAIIAILTGASAEDDDFTNDAIDFHLGLMGLEKA*