Scaffold Ga0114910_1105636

Overview

Basic Information

• Taxon OID: 3300008220
• Scaffold ID: Ga0114910_1105636
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 835
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.02
  • Long. (^o): 8.37
  • Depth (m): 2641

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035330	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114910_11056361	F035330	AGGAGG	MKLNKGDKFIATWTPEHINGQENMQGQSITIKGQWDDKSKIERHKKTGKLYITFWDRDKDRYTTANAEIVSVSANIFQSE*