Basic Information | |
---|---|
Taxon OID | 3300008220 Open in IMG/M |
Scaffold ID | Ga0114910_1010830 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3413 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 43.02 | Long. (o) | 8.37 | Alt. (m) | Depth (m) | 2641 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016735 | Metagenome | 245 | Y |
F042083 | Metagenome | 159 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114910_10108301 | F042083 | AGGAG | MARRRMAIPHPSITGMAAGLSVAQYLNQGASTGRATGGVIADTLKGNLEPAFSELSKNAVSLATSAPGKAVLSSAIVLATAGGLARKFFPSVKLGGTKLYFKI* |
Ga0114910_10108306 | F016735 | GGCGG | MTDEIFALVWVLSFGLYLLIYTYWIPLKTQKKIETWLMSEESNETLLASLSVITNQIREQALVDFEEFMIPQGRKAAIDFWNGAMGNAAQKLGETEEGSQLSLLHSMTEELKDQPWYVQAAASKLIPVIQKAAENKPTEKVTKLAHGKFGFD* |
⦗Top⦘ |