Scaffold Ga0114898_1005979

Overview

Basic Information

• Taxon OID: 3300008216
• Scaffold ID: Ga0114898_1005979
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5274
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (58.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.55
  • Long. (^o): 13.18
  • Depth (m): 3511

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015417	Metagenome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114898_10059793	F015417	GAG	MDDFTVLIGILASSSIAINLYLVKSVANLCERIAHLEGKLSSQA*