Scaffold Ga0114856_1000418

Overview

Basic Information

• Taxon OID: 3300008125
• Scaffold ID: Ga0114856_1000418
• Source Dataset Name: Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35493
• Total Scaffold Genes: 53
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 42 (79.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084362	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114856_100041844	F084362	GGAGG	MSLMNCTFTVRWSDDKNKPHAKTYATEDDAKRAKKWLLEHGVRSVDIAVKINNKPAGSLKDDNPSETDAEQKGFWWEK*