| Basic Information | |
|---|---|
| Taxon OID | 3300008119 Open in IMG/M |
| Scaffold ID | Ga0114354_1053363 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1721 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.8271 | Long. (o) | -83.1945 | Alt. (m) | Depth (m) | 7.9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018715 | Metagenome / Metatranscriptome | 233 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114354_10533632 | F018715 | N/A | MSYEEKFRMNQRDIDEANINSQCDSILSKADEHNLQLEVVWSAFKHKEQFRDVSLLECLQVGADEWDV* |
| ⦗Top⦘ |