| Basic Information | |
|---|---|
| Taxon OID | 3300008117 Open in IMG/M |
| Scaffold ID | Ga0114351_1224342 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 957 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.7026 | Long. (o) | -83.2538 | Alt. (m) | Depth (m) | 5.9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054798 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114351_12243422 | F054798 | N/A | MIYLYLNETEKLAEIVSELVKLGMGVVAELHGNKWHIEVSK* |
| ⦗Top⦘ |