Scaffold Ga0114350_1039099

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114350_1039099

Scaffold Ga0114350_1039099

Overview

Basic Information
Taxon OID	3300008116 Open in IMG/M
Scaffold ID	Ga0114350_1039099 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1810
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location Name	Lake Erie, USA
Coordinates	Lat. (^o)	41.7635	Long. (^o)	-83.3309	Alt. (m)		Depth (m)	4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091391	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114350_10390992	F091391	GGA	LTKIDSDDKLSIMAEIYTFTPKQKPTDENVELNRLRAKLLELHEIRDTLNKEIRYTKDAIKLLEKGEK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.