Scaffold Ga0114346_1274206

Overview

Basic Information

• Taxon OID: 3300008113
• Scaffold ID: Ga0114346_1274206
• Source Dataset Name: Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 605
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.8271
  • Long. (^o): -83.1945
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019614	Metagenome / Metatranscriptome	228	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114346_12742062	F019614	N/A	MNVASIASNKIQVEYSAMKGDNREFLTFSVPNGWDDVKKLTNKVLTYNNKDFTFSGWNSDRNECYFVRLVNGPSFVAWIK*