Basic Information | |
---|---|
Taxon OID | 3300008113 Open in IMG/M |
Scaffold ID | Ga0114346_1161877 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 942 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erie, USA | |||||||
Coordinates | Lat. (o) | 41.8271 | Long. (o) | -83.1945 | Alt. (m) | Depth (m) | 8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041152 | Metagenome / Metatranscriptome | 160 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114346_11618772 | F041152 | GAG | MNIVYYIVKNWDTLPKSKFDDDHIVIFKEIENWDGGYGHHSYEGIGVDKDGNVTWCYSSGCSCSGGPSLDTKKDLKVFVVNDGIDLNVDPSTINFDSLQVEFNSY* |
⦗Top⦘ |