NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114346_1026949

Scaffold Ga0114346_1026949


Overview

Basic Information
Taxon OID3300008113 Open in IMG/M
Scaffold IDGa0114346_1026949 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3037
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.8271Long. (o)-83.1945Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060894Metagenome / Metatranscriptome132Y
F074869Metagenome / Metatranscriptome119Y
F084225Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0114346_10269492F084225N/AMSVIISGDKLIVHSYMVPVVFDSIQEPGVRYLIADGKWTPIPNHLGYKHITHFQKEYKGAKNEAFKNTFEQEVDGSKSKKYTVKCEDNIWSCTCPAFGFSGNSGCKHIKQIKDKNGWS*
Ga0114346_10269496F074869N/AMTAELQVRCLEVENWTRSLTMRGMDREEVVYRIDEMYEPESLDEMEAYSEAILYARLGVLN*
Ga0114346_10269497F060894N/AMAFQTRDEAQDKVSRKLDRVLNKKKKQVPLSQESWDDLFRRGASLAEQEEWIVLRRRQKERDINNKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.