NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114345_1046215

Scaffold Ga0114345_1046215


Overview

Basic Information
Taxon OID3300008112 Open in IMG/M
Scaffold IDGa0114345_1046215 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTR
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1278
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.8271Long. (o)-83.1945Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061527Metagenome / Metatranscriptome131N
F066480Metagenome / Metatranscriptome126N
F075720Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0114345_10462151F075720GAGMVNQEDRNFKLFIGGLEMVLGLTKTAITILEYNLSGIVGLFFGIEQWSIVISFYITAHERSLVRHKDTVTEQGARLANHLTIPLIKNMETLRDMCREGRSVETLNKLKAFESHLTYLIQKPRDQWAQWQLKEHIYSVIESEFPKIIQKLQSS
Ga0114345_10462152F061527GAGGMSNYFEQAFSEILSAIKELTIKIGTAIRIEQQKIPADPSISTVHHYHMVVRNKIDQLSSRAAIMNFKTDQYCLIKVYGTLLIMVNRALGESNHKSKYVQLKLLHRMLGDFENNSTFSYWKDHVILGDRAVKETDG*
Ga0114345_10462153F066480N/AEREDQVVSKLLFIQGGQPVYQYRQVLKLLKEMIQELEGYDKKPHLMDNINRYISSIKRRIEYCQIWAENWTQINLFNTEEQVLQEILRYILERIMLCLDIENKVERMKMTYCLKIETFLKIHQTRKQSIENNFILEVTE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.