Scaffold Ga0111541_10120446

Overview

Basic Information

• Taxon OID: 3300008097
• Scaffold ID: Ga0111541_10120446
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1071
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -0.4612
  • Long. (^o): -23.033259

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055181	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111541_101204461	F055181	N/A	MSYYQLADTQKVYKITLNLSVDDDFIPENINWSKVLQLNDYEQVESVIEEG*