NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111541_10003995

Scaffold Ga0111541_10003995


Overview

Basic Information
Taxon OID3300008097 Open in IMG/M
Scaffold IDGa0111541_10003995 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5114
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (52.38%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-0.4612Long. (o)-23.033259Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013897Metagenome / Metatranscriptome267Y
F023877Metagenome / Metatranscriptome208Y
F031447Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0111541_1000399512F023877N/AMKKLKQLIQEYVNDHYNNFGFYPYDVEVDGQVYSYGGYWEILEDRRFD*
Ga0111541_100039954F031447N/AMTTPKELRQYTITGTKTFTYYKTVHATDIVDAHIQAHEPVEDSEDEWTCHWDSDYDEETEENGLMVVTHIEDEGLV*
Ga0111541_100039956F013897N/AMNLSKDQILALMNTIDFATDNDASYEEYTILQSGTSDLEPIRNILYNELIHQTE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.