NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110929_1111216

Scaffold Ga0110929_1111216


Overview

Basic Information
Taxon OID3300008072 Open in IMG/M
Scaffold IDGa0110929_1111216 Open in IMG/M
Source Dataset NameMicrobial Communities in Water bodies, Singapore - Site MA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1114
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058947Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0110929_11112163F058947GGCGGMTISCELQDLEEIMAKAGVLLTGKEYDKAQDYLQENCVCATYNYLKKLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.