| Basic Information | |
|---|---|
| Taxon OID | 3300008072 Open in IMG/M |
| Scaffold ID | Ga0110929_1046313 Open in IMG/M |
| Source Dataset Name | Microbial Communities in Water bodies, Singapore - Site MA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 865 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.3 | Long. (o) | 103.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009669 | Metagenome / Metatranscriptome | 314 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0110929_10463132 | F009669 | N/A | LVQIGVLALLELLTVVAVATAFAIHGDNSLVAFLPDKAEEYIIGISKLIAVVSGIVFALTVKDAAVTGGKIAQTKEAKKRVKKEFGHGENI* |
| ⦗Top⦘ |