| Basic Information | |
|---|---|
| Taxon OID | 3300008055 Open in IMG/M |
| Scaffold ID | Ga0108970_11302244 Open in IMG/M |
| Source Dataset Name | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 902 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netarts Bay, Oregon, USA | |||||||
| Coordinates | Lat. (o) | 45.394187 | Long. (o) | -123.939629 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100651 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0108970_113022442 | F100651 | AGGA | LKHLFEYKKFEPQEMYKEENRRPINIDAVRRTKEYRKLLSLGFKDDTSHQQELNNTLKFIRTKNKQKEIGYDDVFYTIHPTGTVRRYNPPKTKDDDIQEGSGNDLKKFSKPFVRSRDYKQALTYLYGYLLRKQERGDFR* |
| ⦗Top⦘ |