Scaffold Ga0108970_10714758

Overview

Basic Information

• Taxon OID: 3300008055
• Scaffold ID: Ga0108970_10714758
• Source Dataset Name: Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10414
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (41.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location

• Location Name: Netarts Bay, Oregon, USA
• Coordinates
  • Lat. (^o): 45.394187
  • Long. (^o): -123.939629

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027530	Metagenome / Metatranscriptome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0108970_107147584	F027530	GGA	MPNNFPNNPILEPGLDVRVIDGSNSQTLDQLYFIGTANNYVTKTTKTSIQNYSTYGNFWVKEVNVTDNFRDILDGGNSEAGTAQFTGPIIGGEFPTKASLANQL*