Scaffold Ga0098052_1051829

Overview

Basic Information

• Taxon OID: 3300008050
• Scaffold ID: Ga0098052_1051829
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1767
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → environmental samples → uncultured virus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.51
  • Long. (^o): -76.2
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001039	Metagenome / Metatranscriptome	795	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098052_10518292	F001039	AGG	MEINYNLVLYIGIGLIIGGFILFLIAQHFERQADIRLFKLQQLSKSFERAKKNERL*