| Basic Information | |
|---|---|
| Taxon OID | 3300008042 Open in IMG/M |
| Scaffold ID | Ga0100406_1334657 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Puerto Morelos, Mexico - Orbicella 8 C C metatranscriptome (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2240 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico:La Bocana,Puerto Morelos | |||||||
| Coordinates | Lat. (o) | 20.8778 | Long. (o) | -86.8431 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038986 | Metagenome / Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0100406_13346571 | F038986 | GAG | MNQILRCDWLPERARWSYLARLGLPAVSRKKNFPESHIINPLLTKLVRSRWLDIGLILFLRVY |
| ⦗Top⦘ |