| Basic Information | |
|---|---|
| Taxon OID | 3300008039 Open in IMG/M |
| Scaffold ID | Ga0099802_1162969 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Puerto Morelos, Mexico - Orbicella 8 T B metatranscriptome (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico:La Bocana,Puerto Morelos | |||||||
| Coordinates | Lat. (o) | 20.8778 | Long. (o) | -86.8431 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063338 | Metagenome / Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099802_11629691 | F063338 | N/A | GRHVGAHTDGHQHGVSIQISINLGKKFLRISCIRKIAVTRILAKVFVYLRSFISQILDLIY*TVLILILIYFEWRDTENQQYKYKAMKAEFRISRKC* |
| ⦗Top⦘ |