Scaffold Ga0099805_1234761

Overview

Basic Information

• Taxon OID: 3300008038
• Scaffold ID: Ga0099805_1234761
• Source Dataset Name: Coral microbial communities from Puerto Morelos, Mexico - Orbicella C B metatranscriptome (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 797
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Mexico:Petempiche,Puerto Morelos
• Coordinates
  • Lat. (^o): 20.9047
  • Long. (^o): -86.8367

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009797	Metagenome / Metatranscriptome	312	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099805_12347611	F009797	N/A	MLPWQRYIRQLNHQKTKVCVVNLLAAIFGDRGIKGFRGKGE*