NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099803_1085885

Scaffold Ga0099803_1085885


Overview

Basic Information
Taxon OID3300008037 Open in IMG/M
Scaffold IDGa0099803_1085885 Open in IMG/M
Source Dataset NameCoral microbial communities from Puerto Morelos, Mexico - Orbicella 8 T C metatranscriptome (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1311
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NameMexico:La Bocana,Puerto Morelos
CoordinatesLat. (o)20.8778Long. (o)-86.8431Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043414Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0099803_10858851F043414GGCGGMADVSTGLKIVRLHPDIFHVDFMTMEQVTEKRLSRNHLTFNFWGDMSIALMNEKPKLAKRLQKIQMNPNFRHHPVWDYYEWILHKSRYMKACERAGIPMIDTIHLEKGFNARDVLKKIVAKGWDKFFVKPAYMSFFGAGVINGKTQDFIDNIEPLLQYEAENKHQKEFLVQPYMLKPNGEVFDEIRNFFCDGEWAYSVYTDGVDYEGFWEQPKGKLKEACKKLAIQTMEEVKKVHKWEGKRINSLLNRIDIGIIPDKSRKLGYRIFVNEIEPQMTTWLGRYCPFVIQDRMAEVCVKQAHEMLKRSLAAKRKMPSPQKVRQLLDVLEQRLKES*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.