Basic Information | |
---|---|
Taxon OID | 3300008030 Open in IMG/M |
Scaffold ID | Ga0099821_1003186 Open in IMG/M |
Source Dataset Name | Coral microbial communities from Puerto Morelos, Mexico - Siderastrea T C metatranscriptome (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 877 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico:El Islote,Puerto Morelos | |||||||
Coordinates | Lat. (o) | 21.0853 | Long. (o) | -87.0617 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041010 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099821_10031861 | F041010 | N/A | MHRKTINALMKWPANTVKMRLPLTIPRPESFAETGVRDLENDP |
⦗Top⦘ |