| Basic Information | |
|---|---|
| Taxon OID | 3300008013 Open in IMG/M |
| Scaffold ID | Ga0099809_10987039 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 531 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico:Petempiche,Puerto Morelos | |||||||
| Coordinates | Lat. (o) | 20.9047 | Long. (o) | -86.8367 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089860 | Metagenome / Metatranscriptome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099809_109870391 | F089860 | N/A | VYAAGVCANVYKANLLTDIVSKVMANVLLPEMRNCLRNCPKMKLYRVTGVQSVVMNEFS |
| ⦗Top⦘ |