Scaffold Ga0105748_10030066

Overview

Basic Information

• Taxon OID: 3300007992
• Scaffold ID: Ga0105748_10030066
• Source Dataset Name: Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2068
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location

• Location Name: Oregon, USA
• Coordinates
  • Lat. (^o): 46.235
  • Long. (^o): -123.9123
  • Depth (m): 10.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025596	Metagenome / Metatranscriptome	201	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105748_100300665	F025596	N/A	MSKYTNTLANLSYLFGMAILILGLVDRKMRLMAVSDVQWVILSLVLGIFFPILLNALFFKKFSMHFWNKFN*