Scaffold Ga0108968_12705160

Overview

Basic Information

• Taxon OID: 3300007989
• Scaffold ID: Ga0108968_12705160
• Source Dataset Name: Microbial communities of Eelgrass leaves from Netarts Bay, Oregon, USA.Combined Assembly of Gp0128395, Gp0128394
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 599
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location

• Location Name: Netarts Bay, Oregon, USA
• Coordinates
  • Lat. (^o): 45.394187
  • Long. (^o): -123.939629

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075465	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0108968_127051601	F075465	AGG	MKQDGDWAATQLSGDPLTLYALIEKTILAQTEDQYPFATVYEQEVGLYSFRQENMSNPQWYERFNTKVDVGTAIGVTRQHKVLLEFVAQEVHTTSFDDLNDDQKESVREDAEERYLAYVFFKQSGKQHLNCKEDIQNEFTKGNNRYPKTRPQVLHLLDKYT