| Basic Information | |
|---|---|
| Taxon OID | 3300007989 Open in IMG/M |
| Scaffold ID | Ga0108968_10423016 Open in IMG/M |
| Source Dataset Name | Microbial communities of Eelgrass leaves from Netarts Bay, Oregon, USA.Combined Assembly of Gp0128395, Gp0128394 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netarts Bay, Oregon, USA | |||||||
| Coordinates | Lat. (o) | 45.394187 | Long. (o) | -123.939629 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012457 | Metagenome | 280 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0108968_104230161 | F012457 | AGGAG | MMIKDLEMSKDLDRDALTAVRGGRNSIEQGGVYAPVANVGGGFSFGSPTNIVSAPVNAPSAVLNDNDLQLKLANKTANVLGSLGTEIWQ* |
| ⦗Top⦘ |