Scaffold Ga0102924_1004830

Overview

Basic Information

• Taxon OID: 3300007982
• Scaffold ID: Ga0102924_1004830
• Source Dataset Name: Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13332
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: Banff, British Columbia
• Coordinates
  • Lat. (^o): 51.1699
  • Long. (^o): -116.1578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050035	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102924_10048304	F050035	GGAGG	VENQPGSRTGAAAPTEAQSARREWAEPLLAGVIVSLIAEAKDAGWSGRLEYVVEMCVQEMTSTLGMSREDVIETILRWSGELGETLTREDVEKAIS*