NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105747_1101973

Scaffold Ga0105747_1101973


Overview

Basic Information
Taxon OID3300007974 Open in IMG/M
Scaffold IDGa0105747_1101973 Open in IMG/M
Source Dataset NameCoastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)896
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location NameOregon, USA
CoordinatesLat. (o)46.2357Long. (o)-123.9163Alt. (m)Depth (m)1.2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074867Metagenome / Metatranscriptome119N
F078696Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0105747_11019732F074867GGAGMSSRGITDIILNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKTGDVVSIIQVCAIPANGRKFPNWWNRDGVGEAVISAGLVNVTTSVTHFLAKALTAGTETDIKTVGSESDEKK*
Ga0105747_11019733F078696AGGMKLWSSAVTYLNVQPSEAWNLTPFEFWALWDTHLEKMEISTGKAYTRPMTMDEFKELNDYLDELHGDN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.