Scaffold Ga0105746_1017778

Overview

Basic Information

• Taxon OID: 3300007973
• Scaffold ID: Ga0105746_1017778
• Source Dataset Name: Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2087
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location

• Location Name: Oregon, USA
• Coordinates
  • Lat. (^o): 46.2357
  • Long. (^o): -123.9153
  • Depth (m): 1.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048938	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105746_10177783	F048938	AGGA	MNVEETKEAIHVMKAFVDGKDLEVLGPVGKWEPLYFPRWGWDDTKYRIKPTYVLRPWTADEVPLGMQARNREYPKTRWLIDRTSSEENRKDWCEKYEHSIDGGKTWLPCGVIEESK*