| Basic Information | |
|---|---|
| Taxon OID | 3300007972 Open in IMG/M |
| Scaffold ID | Ga0105745_1170608 Open in IMG/M |
| Source Dataset Name | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 674 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oregon, USA | |||||||
| Coordinates | Lat. (o) | 46.2357 | Long. (o) | -123.9153 | Alt. (m) | Depth (m) | 1.2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065441 | Metagenome / Metatranscriptome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105745_11706082 | F065441 | N/A | LNDLKYDGSYWKLFHNELVRHNNNKETVFWKKGFEILQNIQDRSTLEKQVKCARDPISMTTKNEKPSETNTTQSKSPVGNSNAVDILDMKKQFK* |
| ⦗Top⦘ |