| Basic Information | |
|---|---|
| Taxon OID | 3300007918 Open in IMG/M |
| Scaffold ID | Ga0111545_1067566 Open in IMG/M |
| Source Dataset Name | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Liverpool |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom | |||||||
| Coordinates | Lat. (o) | 54.9632021 | Long. (o) | -1.6348029 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080201 | Metagenome / Metatranscriptome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0111545_10675661 | F080201 | AGGA | LKCRKCEGAIVYPEGLSGEKICSKCGLVIDEAPTFKSYTQWNPEWYSNWNEQDSETLKEWLTTLRALSCQLNIPNFPYREEAARTIRTHNKVLFRSQKLTKNKRATLAALMHLILKEYDKMRPIKEISKELSLDNKLVMKQIWIIGKTLNGKKGQLKIQRKT |
| ⦗Top⦘ |