Basic Information | |
---|---|
Taxon OID | 3300007918 Open in IMG/M |
Scaffold ID | Ga0111545_1031503 Open in IMG/M |
Source Dataset Name | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Liverpool |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 998 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | United Kingdom | |||||||
Coordinates | Lat. (o) | 54.9632021 | Long. (o) | -1.6348029 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032176 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111545_10315032 | F032176 | AGCAG | MISVTAQSMTPPKGVGMAKDQGIFRTTTGDMGVLKGIDIAKMSADKTISVGLWGFMTSSEKLGWMNELIAVVEFEALDPMWQDFNIKIYEWT* |
⦗Top⦘ |